Lineage for d4b0nb1 (4b0n B:36-265)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917616Species Ectocarpus siliculosus [TaxId:2880] [267920] (1 PDB entry)
  8. 2917619Domain d4b0nb1: 4b0n B:36-265 [265911]
    automated match to d1tedb1
    complexed with acd, mla

Details for d4b0nb1

PDB Entry: 4b0n (more details), 2.85 Å

PDB Description: crystal structure of pks-i from the brown algae ectocarpus siliculosus
PDB Compounds: (B:) polyketide synthase III

SCOPe Domain Sequences for d4b0nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b0nb1 c.95.1.0 (B:36-265) automated matches {Ectocarpus siliculosus [TaxId: 2880]}
kdeqtvypviagmaignpqyrctqnealavaskcpglesikpvleriygnsrigsryfav
pdftpgraakgdplfypadgsyqvpvdvrldkfkekavplvsdvarraikeaglnvedis
klvvvsstgflgpgldceliknlgltrsvdrtligfmgcaaamngfrnandyvtanpgky
almicvelssvhttfddnindailhaifadgcaaavlkgarksecpkgtl

SCOPe Domain Coordinates for d4b0nb1:

Click to download the PDB-style file with coordinates for d4b0nb1.
(The format of our PDB-style files is described here.)

Timeline for d4b0nb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4b0nb2