SCOPe 2.07: Domain d4b0nb1: 4b0n B:36-265

Lineage for d4b0nb1 (4b0n B:36-265)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (63 species)
   not a true protein

7. Species Ectocarpus siliculosus [TaxId:2880] [267920] (1 PDB entry)

8. Domain d4b0nb1: 4b0n B:36-265 [265911]
   automated match to d1tedb1
   complexed with acd, mla

Details for d4b0nb1

PDB Entry: 4b0n, 2.85 Å

PDB Description: crystal strucutre of pks-i from the brown algae ectocarpus siliculosus

PDB Compounds: (B:) polyketide synthase III

SCOPe Domain Sequences for d4b0nb1:

Sequence; same for both SEQRES and ATOM records:

>d4b0nb1 c.95.1.0 (B:36-265) automated matches {Ectocarpus siliculosus [TaxId: 2880]}
kdeqtvypviagmaignpqyrctqnealavaskcpglesikpvleriygnsrigsryfav
pdftpgraakgdplfypadgsyqvpvdvrldkfkekavplvsdvarraikeaglnvedis
klvvvsstgflgpgldceliknlgltrsvdrtligfmgcaaamngfrnandyvtanpgky
almicvelssvhttfddnindailhaifadgcaaavlkgarksecpkgtl

Timeline for d4b0nb1:

• d4b0nb1 first appeared in SCOPe 2.05
  
• d4b0nb1 appears in SCOPe 2.06