Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.0: automated matches [191381] (1 protein) not a true family |
Protein automated matches [190475] (8 species) not a true protein |
Species Trypanosoma cruzi [TaxId:5693] [267919] (1 PDB entry) |
Domain d4az1a_: 4az1 A: [265907] automated match to d3m4ub_ complexed with edo, fmt |
PDB Entry: 4az1 (more details), 2.18 Å
SCOPe Domain Sequences for d4az1a_:
Sequence, based on SEQRES records: (download)
>d4az1a_ c.45.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]} dsncfpftklsvqaqyervqrefslllrqedprsisfatslknrhknryldilaneatly pqvtdapgastpyyingnlidldlphkfvacqapvvqgipdflamlyekkislvimvtkl eeggfvkadrywpeergsgsiavsgncgltisedpgkayevedelkitrrylilqradep phkftqvqytgwpdhgipqsatslealltnvknspttvpvvvhcsagigrtgtligayaa lthlergtltdttvydvvsamrrqrfgmvqrmeqyfviyltlmcrlgvdikalvglln
>d4az1a_ c.45.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]} dsncfpftklsvqaqyervqrefslllrqedprsisfatslknrhknryldilaneatly pqvtdstpyyingnlidldlphkfvacqapvvqgipdflamlyekkislvimvtkleegg fvkadrywpeergsgsiavsgncgltisedpgkayevedelkitrrylilqradepphkf tqvqytgwpdhgipqsatslealltnvknspttvpvvvhcsagigrtgtligayaalthl ergtltdttvydvvsamrrqrfgmvqrmeqyfviyltlmcrlgvdikalvglln
Timeline for d4az1a_: