Lineage for d4a64d_ (4a64 D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007926Superfamily a.118.17: Cullin repeat-like [74788] (3 families) (S)
  5. 2007947Family a.118.17.0: automated matches [196491] (1 protein)
    not a true family
  6. 2007948Protein automated matches [196508] (2 species)
    not a true protein
  7. 2007949Species Human (Homo sapiens) [TaxId:9606] [256186] (4 PDB entries)
  8. 2007953Domain d4a64d_: 4a64 D: [265900]
    Other proteins in same PDB: d4a64a2, d4a64b2
    automated match to d4ap2b_
    complexed with edo

Details for d4a64d_

PDB Entry: 4a64 (more details), 2.57 Å

PDB Description: Crystal structure of the N-terminal domain of human Cul4B at 2.57A resolution
PDB Compounds: (D:) Cullin-4B

SCOPe Domain Sequences for d4a64d_:

Sequence, based on SEQRES records: (download)

>d4a64d_ a.118.17.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
detwqklkeaveaiqnstsikynleelyqavenlcsykisanlykqlrqicedhikaqih
qfredsldsvlflkkidrcwqnhcrqmimirsiflfldrtyvlqnsmlpsiwdmglelfr
ahiisdqkvqnktidgillliererngeaidrsllrsllsmlsdlqiyqdsfeqrfleet
nrlyaaegqklmqerevpeylhhvnkrleeeadrlityldqttqksliatvekqllgehl
tailqkglnnlldenriqdlsllyqlfsrvrggvqvllqqwieyikafgstivinpekdk
tmrqelddfkdkvdhiidicflknekfinamkeafet

Sequence, based on observed residues (ATOM records): (download)

>d4a64d_ a.118.17.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
detwqklkeaveaiqnstsikynleelyqavenlcnlykqlrqicedhikaqihqfredl
dsvlflkkidrcwqnhcrqmimirsiflfldrtyvlqnsmlpsiwdmglelfrahiisdq
kvqnktidgillliererngeaidrsllrsllsmlsdlqiyqdsfeqrfleetnrlyaae
gqklmqerevpeylhhvnkrleeeadrlityldqttqksliatvekqllgehltailqkg
lnnlldenriqdlsllyqlfsrvrggvqvllqqwieyikafgstivielddfkdkvdhii
dicflknekfinamkeafet

SCOPe Domain Coordinates for d4a64d_:

Click to download the PDB-style file with coordinates for d4a64d_.
(The format of our PDB-style files is described here.)

Timeline for d4a64d_: