Lineage for d4a64a1 (4a64 A:188-533)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2334463Superfamily a.118.17: Cullin repeat-like [74788] (3 families) (S)
  5. 2334484Family a.118.17.0: automated matches [196491] (1 protein)
    not a true family
  6. 2334485Protein automated matches [196508] (2 species)
    not a true protein
  7. 2334486Species Human (Homo sapiens) [TaxId:9606] [256186] (4 PDB entries)
  8. 2334487Domain d4a64a1: 4a64 A:188-533 [265897]
    Other proteins in same PDB: d4a64a2, d4a64b2
    automated match to d4ap2b_
    complexed with edo

Details for d4a64a1

PDB Entry: 4a64 (more details), 2.57 Å

PDB Description: crystal structure of the n-terminal domain of human cul4b at 2.57a resolution
PDB Compounds: (A:) Cullin-4B

SCOPe Domain Sequences for d4a64a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a64a1 a.118.17.0 (A:188-533) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pklpenytdetwqklkeaveaiqnstsikynleelyqavenlcsykisanlykqlrqice
dhikaqihqfredsldsvlflkkidrcwqnhcrqmimirsiflfldrtyvlqnsmlpsiw
dmglelfrahiisdqkvqnktidgillliererngeaidrsllrsllsmlsdlqiyqdsf
eqrfleetnrlyaaegqklmqerevpeylhhvnkrleeeadrlityldqttqksliatve
kqllgehltailqkglnnlldenriqdlsllyqlfsrvrggvqvllqqwieyikafgsti
vinpekdktmrqelddfkdkvdhiidicflknekfinamkeafetf

SCOPe Domain Coordinates for d4a64a1:

Click to download the PDB-style file with coordinates for d4a64a1.
(The format of our PDB-style files is described here.)

Timeline for d4a64a1: