SCOPe 2.08: Domain d4a64a1: 4a64 A:188-533

Lineage for d4a64a1 (4a64 A:188-533)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.17: Cullin repeat-like [74788] (3 families)

5. Family a.118.17.0: automated matches [196491] (1 protein)
   not a true family

6. Protein automated matches [196508] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256186] (5 PDB entries)

8. Domain d4a64a1: 4a64 A:188-533 [265897]
   Other proteins in same PDB: d4a64a2, d4a64b2
   automated match to d4ap2b_
   complexed with edo

Details for d4a64a1

PDB Entry: 4a64, 2.57 Å

PDB Description: crystal structure of the n-terminal domain of human cul4b at 2.57a resolution

PDB Compounds: (A:) Cullin-4B

SCOPe Domain Sequences for d4a64a1:

Sequence; same for both SEQRES and ATOM records:

>d4a64a1 a.118.17.0 (A:188-533) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pklpenytdetwqklkeaveaiqnstsikynleelyqavenlcsykisanlykqlrqice
dhikaqihqfredsldsvlflkkidrcwqnhcrqmimirsiflfldrtyvlqnsmlpsiw
dmglelfrahiisdqkvqnktidgillliererngeaidrsllrsllsmlsdlqiyqdsf
eqrfleetnrlyaaegqklmqerevpeylhhvnkrleeeadrlityldqttqksliatve
kqllgehltailqkglnnlldenriqdlsllyqlfsrvrggvqvllqqwieyikafgsti
vinpekdktmrqelddfkdkvdhiidicflknekfinamkeafetf

Timeline for d4a64a1:

• d4a64a1 first appeared in SCOPe 2.05, called d4a64a_
  
• d4a64a1 appears in SCOPe 2.07