![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.17: Cullin repeat-like [74788] (3 families) ![]() |
![]() | Family a.118.17.0: automated matches [196491] (1 protein) not a true family |
![]() | Protein automated matches [196508] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [256186] (5 PDB entries) |
![]() | Domain d4a64a1: 4a64 A:188-533 [265897] Other proteins in same PDB: d4a64a2, d4a64b2 automated match to d4ap2b_ complexed with edo |
PDB Entry: 4a64 (more details), 2.57 Å
SCOPe Domain Sequences for d4a64a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a64a1 a.118.17.0 (A:188-533) automated matches {Human (Homo sapiens) [TaxId: 9606]} pklpenytdetwqklkeaveaiqnstsikynleelyqavenlcsykisanlykqlrqice dhikaqihqfredsldsvlflkkidrcwqnhcrqmimirsiflfldrtyvlqnsmlpsiw dmglelfrahiisdqkvqnktidgillliererngeaidrsllrsllsmlsdlqiyqdsf eqrfleetnrlyaaegqklmqerevpeylhhvnkrleeeadrlityldqttqksliatve kqllgehltailqkglnnlldenriqdlsllyqlfsrvrggvqvllqqwieyikafgsti vinpekdktmrqelddfkdkvdhiidicflknekfinamkeafetf
Timeline for d4a64a1:
![]() Domains from other chains: (mouse over for more information) d4a64b1, d4a64b2, d4a64c_, d4a64d_ |