SCOPe 2.08: Domain d4a19c_: 4a19 C:

Lineage for d4a19c_ (4a19 C:)

1. Root: SCOPe 2.08

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (3 proteins)

6. Protein Eukaryotic, cytoplasmic (60S subunit) [267687] (1 species)

7. Species Tetrahymena thermophila [TaxId:5911] [268006] (2 PDB entries)

8. Domain d4a19c_: 4a19 C: [265881]
   protein/RNA complex; complexed with zn

Details for d4a19c_

PDB Entry: 4a19, 3.52 Å

PDB Description: T.thermophila 60S ribosomal subunit in complex with initiation factor 6. This file contains 26S rRNA and proteins of molecule 2.

PDB Compounds: (C:) 60s ribosomal protein l36a

SCOPe Domain Sequences for d4a19c_:

Sequence; same for both SEQRES and ATOM records:

>d4a19c_ i.1.1.2 (C:) Eukaryotic, cytoplasmic (60S subunit) {Tetrahymena thermophila [TaxId: 5911]}
vqvpktrktyckkcnshtnhkvsqykkskesthaqgrrrydmkqsgfggqtkpifrkkak
ttkkvalkfdcttcktkrvipikrcktivfmditqikkakvnk

Timeline for d4a19c_:

• d4a19c_ first appeared in SCOPe 2.05
  
• d4a19c_ appears in SCOPe 2.07