Lineage for d3zn1b1 (3zn1 B:308-375)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1968224Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1969543Superfamily h.1.35: Demethylase interaction domain of CoREST [267603] (1 family) (S)
    Includes N-terminal part of Pfam PF01448, ELM2 domain, which interacts with LSD1
  5. 1969544Family h.1.35.1: Demethylase interaction domain of CoREST [267619] (1 protein)
  6. 1969545Protein Demethylase interaction domain of CoREST [267660] (1 species)
  7. 1969546Species Human (Homo sapiens) [TaxId:9606] [267739] (21 PDB entries)
  8. 1969553Domain d3zn1b1: 3zn1 B:308-375 [265852]
    Other proteins in same PDB: d3zn1a1, d3zn1a2, d3zn1a3, d3zn1b2
    complexed with fad

Details for d3zn1b1

PDB Entry: 3zn1 (more details), 3.1 Å

PDB Description: LSD1-CoREST in complex with PRLYLV peptide
PDB Compounds: (B:) rest corepressor 1

SCOPe Domain Sequences for d3zn1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zn1b1 h.1.35.1 (B:308-375) Demethylase interaction domain of CoREST {Human (Homo sapiens) [TaxId: 9606]}
rkppkgmflsqedveavsanataattvlrqldmelvsvkrqiqnikqtnsalkekldggi
epyrlpev

SCOPe Domain Coordinates for d3zn1b1:

Click to download the PDB-style file with coordinates for d3zn1b1.
(The format of our PDB-style files is described here.)

Timeline for d3zn1b1: