| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
| Family a.4.1.3: Myb/SANT domain [46739] (16 proteins) |
| Protein REST corepressor 1, CoREST [140165] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [140166] (23 PDB entries) Uniprot Q9UKL0 376-440 |
| Domain d3zmzb2: 3zmz B:376-440 [265843] Other proteins in same PDB: d3zmza1, d3zmza2, d3zmza3, d3zmzb1 complexed with fad |
PDB Entry: 3zmz (more details), 3 Å
SCOPe Domain Sequences for d3zmzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zmzb2 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]}
iqkcnarwtteeqllavqairkygrdfqaisdvignksvvqvknffvnyrrrfnidevlq
eweae
Timeline for d3zmzb2: