SCOPe 2.08: Domain d3zmza3: 3zmz A:655-763

Lineage for d3zmza3 (3zmz A:655-763)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)

6. Protein Lysine-specific histone demethylase 1, LSD1 [159953] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159954] (27 PDB entries)
   Uniprot O60341 655-763

8. Domain d3zmza3: 3zmz A:655-763 [265841]
   Other proteins in same PDB: d3zmza1, d3zmza2, d3zmzb1, d3zmzb2
   complexed with fad

Details for d3zmza3

PDB Entry: 3zmz, 3 Å

PDB Description: LSD1-CoREST in complex with PRSFAV peptide

PDB Compounds: (A:) Lysine-specific histone demethylase 1A

SCOPe Domain Sequences for d3zmza3:

Sequence; same for both SEQRES and ATOM records:

>d3zmza3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
gfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvageaagi
menisddvivgrclailkgifgssavpqpketvvsrwradpwargsysy

Timeline for d3zmza3:

• d3zmza3 first appeared in SCOPe 2.05
  
• d3zmza3 appears in SCOPe 2.07