Lineage for d3zmvb1 (3zmv B:308-375)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2590058Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2591443Superfamily h.1.35: Demethylase interaction domain of CoREST [267603] (1 family) (S)
    Includes N-terminal part of Pfam PF01448, ELM2 domain, which interacts with LSD1
  5. 2591444Family h.1.35.1: Demethylase interaction domain of CoREST [267619] (1 protein)
  6. 2591445Protein Demethylase interaction domain of CoREST [267660] (1 species)
  7. 2591446Species Human (Homo sapiens) [TaxId:9606] [267739] (22 PDB entries)
  8. 2591455Domain d3zmvb1: 3zmv B:308-375 [265837]
    Other proteins in same PDB: d3zmva1, d3zmva2, d3zmva3, d3zmvb2
    complexed with fad

Details for d3zmvb1

PDB Entry: 3zmv (more details), 3 Å

PDB Description: LSD1-CoREST in complex with PLSFLV peptide
PDB Compounds: (B:) rest corepressor 1

SCOPe Domain Sequences for d3zmvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zmvb1 h.1.35.1 (B:308-375) Demethylase interaction domain of CoREST {Human (Homo sapiens) [TaxId: 9606]}
rkppkgmflsqedveavsanataattvlrqldmelvsvkrqiqnikqtnsalkekldggi
epyrlpev

SCOPe Domain Coordinates for d3zmvb1:

Click to download the PDB-style file with coordinates for d3zmvb1.
(The format of our PDB-style files is described here.)

Timeline for d3zmvb1: