Lineage for d3zmub2 (3zmu B:376-440)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2304502Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2304761Family a.4.1.3: Myb/SANT domain [46739] (16 protein domains)
  6. 2304816Protein REST corepressor 1, CoREST [140165] (1 species)
  7. 2304817Species Human (Homo sapiens) [TaxId:9606] [140166] (23 PDB entries)
    Uniprot Q9UKL0 376-440
  8. 2304826Domain d3zmub2: 3zmu B:376-440 [265833]
    Other proteins in same PDB: d3zmua1, d3zmua2, d3zmua3, d3zmub1
    complexed with fad

Details for d3zmub2

PDB Entry: 3zmu (more details), 3.2 Å

PDB Description: LSD1-CoREST in complex with PKSFLV peptide
PDB Compounds: (B:) rest corepressor 1

SCOPe Domain Sequences for d3zmub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zmub2 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]}
iqkcnarwtteeqllavqairkygrdfqaisdvignksvvqvknffvnyrrrfnidevlq
eweae

SCOPe Domain Coordinates for d3zmub2:

Click to download the PDB-style file with coordinates for d3zmub2.
(The format of our PDB-style files is described here.)

Timeline for d3zmub2: