Lineage for d3zmtb2 (3zmt B:376-440)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692037Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)
  6. 2692092Protein REST corepressor 1, CoREST [140165] (1 species)
  7. 2692093Species Human (Homo sapiens) [TaxId:9606] [140166] (23 PDB entries)
    Uniprot Q9UKL0 376-440
  8. 2692098Domain d3zmtb2: 3zmt B:376-440 [265828]
    Other proteins in same PDB: d3zmta1, d3zmta2, d3zmta3, d3zmtb1
    complexed with fad
    has additional insertions and/or extensions that are not grouped together

Details for d3zmtb2

PDB Entry: 3zmt (more details), 3.1 Å

PDB Description: LSD1-CoREST in complex with PRSFLV peptide
PDB Compounds: (B:) rest corepressor 1

SCOPe Domain Sequences for d3zmtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zmtb2 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]}
iqkcnarwtteeqllavqairkygrdfqaisdvignksvvqvknffvnyrrrfnidevlq
eweae

SCOPe Domain Coordinates for d3zmtb2:

Click to download the PDB-style file with coordinates for d3zmtb2.
(The format of our PDB-style files is described here.)

Timeline for d3zmtb2: