Lineage for d3zmta1 (3zmt A:172-273)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692654Family a.4.1.18: SWIRM domain [140222] (4 proteins)
    Pfam PF04433; contains extra N-terminal helix
  6. 2692655Protein Lysine-specific histone demethylase 1, LSD1 [140227] (1 species)
  7. 2692656Species Human (Homo sapiens) [TaxId:9606] [140228] (28 PDB entries)
    Uniprot O60341 169-279
  8. 2692665Domain d3zmta1: 3zmt A:172-273 [265824]
    Other proteins in same PDB: d3zmta2, d3zmta3, d3zmtb1, d3zmtb2
    complexed with fad

Details for d3zmta1

PDB Entry: 3zmt (more details), 3.1 Å

PDB Description: LSD1-CoREST in complex with PRSFLV peptide
PDB Compounds: (A:) Lysine-specific histone demethylase 1A

SCOPe Domain Sequences for d3zmta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zmta1 a.4.1.18 (A:172-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
sgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqltf
eatlqqleapynsdtvlvhrvhsylerhglinfgiykrikpl

SCOPe Domain Coordinates for d3zmta1:

Click to download the PDB-style file with coordinates for d3zmta1.
(The format of our PDB-style files is described here.)

Timeline for d3zmta1: