SCOPe 2.05: Domain d3zmsa1: 3zms A:172-273

Lineage for d3zmsa1 (3zms A:172-273)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.18: SWIRM domain [140222] (4 proteins)
   Pfam PF04433; contains extra N-terminal helix

6. Protein Lysine-specific histone demethylase 1, LSD1 [140227] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140228] (28 PDB entries)
   Uniprot O60341 169-279

8. Domain d3zmsa1: 3zms A:172-273 [265819]
   Other proteins in same PDB: d3zmsa2, d3zmsa3, d3zmsb1, d3zmsb2
   complexed with fad

Details for d3zmsa1

PDB Entry: 3zms, 2.96 Å

PDB Description: LSD1-CoREST in complex with INSM1 peptide

PDB Compounds: (A:) Lysine-specific histone demethylase 1A

SCOPe Domain Sequences for d3zmsa1:

Sequence; same for both SEQRES and ATOM records:

>d3zmsa1 a.4.1.18 (A:172-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
sgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqltf
eatlqqleapynsdtvlvhrvhsylerhglinfgiykrikpl

Timeline for d3zmsa1:

• d3zmsa1 is new in SCOPe 2.05-stable
  
• d3zmsa1 appears in SCOPe 2.06
  
• d3zmsa1 appears in the current release, SCOPe 2.08