| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
| Family a.4.1.18: SWIRM domain [140222] (4 proteins) Pfam PF04433; contains extra N-terminal helix |
| Protein Lysine-specific histone demethylase 1, LSD1 [140227] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [140228] (28 PDB entries) Uniprot O60341 169-279 |
| Domain d3zmsa1: 3zms A:172-273 [265819] Other proteins in same PDB: d3zmsa2, d3zmsa3, d3zmsb1, d3zmsb2 complexed with fad |
PDB Entry: 3zms (more details), 2.96 Å
SCOPe Domain Sequences for d3zmsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zmsa1 a.4.1.18 (A:172-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
sgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqltf
eatlqqleapynsdtvlvhrvhsylerhglinfgiykrikpl
Timeline for d3zmsa1: