Lineage for d3zk5a_ (3zk5 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (68 species)
    not a true protein
  7. 2332232Species Streptomyces venezuelae [TaxId:54571] [255065] (14 PDB entries)
  8. 2332248Domain d3zk5a_: 3zk5 A: [265813]
    automated match to d4dnja_
    complexed with hem, z18; mutant

Details for d3zk5a_

PDB Entry: 3zk5 (more details), 1.89 Å

PDB Description: PikC D50N mutant bound to the 10-DML analog with the 3-(N,N-dimethylamino)ethanoate anchoring group
PDB Compounds: (A:) cytochrome p450 hydroxylase pikc

SCOPe Domain Sequences for d3zk5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zk5a_ a.104.1.0 (A:) automated matches {Streptomyces venezuelae [TaxId: 54571]}
asppvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladpr
fskdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdg
lvdamlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqt
amaemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettv
nliangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvi
pagdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavr
allercpdlaldvspgelvwypnpmirglkalpirwr

SCOPe Domain Coordinates for d3zk5a_:

Click to download the PDB-style file with coordinates for d3zk5a_.
(The format of our PDB-style files is described here.)

Timeline for d3zk5a_: