![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Streptomyces venezuelae [TaxId:54571] [255065] (14 PDB entries) |
![]() | Domain d3zk5a_: 3zk5 A: [265813] automated match to d4dnja_ complexed with hem, z18; mutant |
PDB Entry: 3zk5 (more details), 1.89 Å
SCOPe Domain Sequences for d3zk5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zk5a_ a.104.1.0 (A:) automated matches {Streptomyces venezuelae [TaxId: 54571]} asppvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladpr fskdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdg lvdamlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqt amaemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettv nliangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvi pagdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavr allercpdlaldvspgelvwypnpmirglkalpirwr
Timeline for d3zk5a_: