Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.8: Aerolisin/ETX pore-forming domain [56972] (1 superfamily) 3 domains: (1) alpha+beta; (2&3) all-beta |
Superfamily f.8.1: Aerolisin/ETX pore-forming domain [56973] (3 families) |
Family f.8.1.3: Clostridium perfringens enterotoxin (CPE), pore-forming domain [267612] (2 proteins) N-terminal part of Pfam PF03505, PubMed 21489981 |
Protein automated matches [267674] (1 species) not a true protein |
Species Clostridium perfringens [TaxId:1502] [267811] (3 PDB entries) |
Domain d3zixf1: 3zix F:38-199 [265811] Other proteins in same PDB: d3zixa2, d3zixa3, d3zixb2, d3zixb3, d3zixc2, d3zixc3, d3zixd2, d3zixd3, d3zixe2, d3zixe3, d3zixf2, d3zixf3 automated match to d3am2a2 complexed with p6g |
PDB Entry: 3zix (more details), 1.9 Å
SCOPe Domain Sequences for d3zixf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zixf1 f.8.1.3 (F:38-199) automated matches {Clostridium perfringens [TaxId: 1502]} sdglyvidkgdgwilgepsvvssqilnpnetgtfsqsltkskevsinvnfsvgftsefiq asveygfgitigeqntiersvsttagpneyvyykvyatyrkyqairishgnisddgsiyk ltgiwlsktsadslgnidqgslietgercvltvpstdiekei
Timeline for d3zixf1: