Class b: All beta proteins [48724] (176 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) |
Family b.2.5.6: RUNT domain [81318] (2 proteins) automatically mapped to Pfam PF00853 |
Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species) synonym: core binding factor alpha, cbfa |
Species Mouse (Mus musculus) [TaxId:10090] [63684] (14 PDB entries) almost identical sequence to the human protein |
Domain d3wtxa_: 3wtx A: [265775] Other proteins in same PDB: d3wtxb_, d3wtxg_ automated match to d1hjbc_ protein/DNA complex |
PDB Entry: 3wtx (more details), 2.8 Å
SCOPe Domain Sequences for d3wtxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wtxa_ b.2.5.6 (A:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Mouse (Mus musculus) [TaxId: 10090]} gelvrtdspnflcsvlpthwrcnktlpiafkvvakgdvpdgtlvtvmagndenysaelrn ataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgprepr
Timeline for d3wtxa_: