Lineage for d3wttc_ (3wtt C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306859Family a.4.5.21: ets domain [46859] (9 proteins)
  6. 2306905Protein automated matches [191121] (2 species)
    not a true protein
  7. 2306906Species Human (Homo sapiens) [TaxId:9606] [193283] (15 PDB entries)
  8. 2306910Domain d3wttc_: 3wtt C: [265772]
    Other proteins in same PDB: d3wtta_, d3wttb_, d3wttf_, d3wttg_
    automated match to d1gvjb_
    protein/DNA complex

Details for d3wttc_

PDB Entry: 3wtt (more details), 2.35 Å

PDB Description: crystal structure of the complex comprised of phosphorylated ets1, runx1, cbfbeta, and the tcralpha gene enhancer dna
PDB Compounds: (C:) Protein C-ets-1

SCOPe Domain Sequences for d3wttc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wttc_ a.4.5.21 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvipaaalagytgsgpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkr
knkpkmnyeklsrglryyydkniihktagkryvyrfvcdlqsllgytpeelhamldvk

SCOPe Domain Coordinates for d3wttc_:

Click to download the PDB-style file with coordinates for d3wttc_.
(The format of our PDB-style files is described here.)

Timeline for d3wttc_: