SCOPe 2.08: Domain d3wttc_: 3wtt C:

Lineage for d3wttc_ (3wtt C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.21: ets domain [46859] (9 proteins)

6. Protein automated matches [191121] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193283] (15 PDB entries)

8. Domain d3wttc_: 3wtt C: [265772]
   Other proteins in same PDB: d3wtta_, d3wttb_, d3wttf_, d3wttg_
   automated match to d1gvjb_
   protein/DNA complex

Details for d3wttc_

PDB Entry: 3wtt, 2.35 Å

PDB Description: crystal structure of the complex comprised of phosphorylated ets1, runx1, cbfbeta, and the tcralpha gene enhancer dna

PDB Compounds: (C:) Protein C-ets-1

SCOPe Domain Sequences for d3wttc_:

Sequence; same for both SEQRES and ATOM records:

>d3wttc_ a.4.5.21 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvipaaalagytgsgpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkr
knkpkmnyeklsrglryyydkniihktagkryvyrfvcdlqsllgytpeelhamldvk

Timeline for d3wttc_:

• d3wttc_ first appeared in SCOPe 2.05
  
• d3wttc_ appears in SCOPe 2.07