Lineage for d3wshf_ (3wsh F:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1886275Fold c.135: NIF3 (NGG1p interacting factor 3)-like [102704] (1 superfamily)
    consist of two intertwined domains; duplication: contains two structural repeats of alpha-beta-(beta-alpha)3 motif with mixed beta-sheet, order: 1432, strand 1 is antiparallel to the rest
  4. 1886276Superfamily c.135.1: NIF3 (NGG1p interacting factor 3)-like [102705] (2 families) (S)
    di-iron binding protein
  5. 1886302Family c.135.1.0: automated matches [191472] (1 protein)
    not a true family
  6. 1886303Protein automated matches [190747] (3 species)
    not a true protein
  7. 1886304Species Methanocaldococcus jannaschii [TaxId:243232] [236411] (8 PDB entries)
  8. 1886343Domain d3wshf_: 3wsh F: [265757]
    automated match to d3wsfa_
    complexed with fe, so4

Details for d3wshf_

PDB Entry: 3wsh (more details), 2.8 Å

PDB Description: EDTA-treated, oxidized HcgD from Methanocaldococcus jannaschii
PDB Compounds: (F:) Putative GTP cyclohydrolase 1 type 2

SCOPe Domain Sequences for d3wshf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wshf_ c.135.1.0 (F:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mkakeiiefietfapkdlaiegdniglqvgdnldkeikklgialdpslsvikkaekegvd
flfthhpllkdpirnftgviykklkilmendiilysahtnldicknglndalaelynlen
pkplydnglgrvgifkgsfeefleitkkyihknpivvkskevddnfklavlsgyglsqss
ikyvaekadvylsgdlthhskilaeelglvvvdathystevfglkkfkeflssnldleii
sldf

SCOPe Domain Coordinates for d3wshf_:

Click to download the PDB-style file with coordinates for d3wshf_.
(The format of our PDB-style files is described here.)

Timeline for d3wshf_: