Lineage for d3wsef_ (3wse F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923316Fold c.135: NIF3 (NGG1p interacting factor 3)-like [102704] (1 superfamily)
    consist of two intertwined domains; duplication: contains two structural repeats of alpha-beta-(beta-alpha)3 motif with mixed beta-sheet, order: 1432, strand 1 is antiparallel to the rest
  4. 2923317Superfamily c.135.1: NIF3 (NGG1p interacting factor 3)-like [102705] (2 families) (S)
    di-iron binding protein
  5. 2923343Family c.135.1.0: automated matches [191472] (1 protein)
    not a true family
  6. 2923344Protein automated matches [190747] (3 species)
    not a true protein
  7. 2923345Species Methanocaldococcus jannaschii [TaxId:243232] [236411] (8 PDB entries)
  8. 2923378Domain d3wsef_: 3wse F: [265745]
    Other proteins in same PDB: d3wsea2
    automated match to d3wsfa_
    complexed with fe2, po4

Details for d3wsef_

PDB Entry: 3wse (more details), 2.5 Å

PDB Description: Reduced HcgD from Methanocaldococcus jannaschii
PDB Compounds: (F:) Putative GTP cyclohydrolase 1 type 2

SCOPe Domain Sequences for d3wsef_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wsef_ c.135.1.0 (F:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mkakeiiefietfapkdlaiegdniglqvgdnldkeikklgialdpslsvikkaekegvd
flfthhpllkdpirnftgviykklkilmendiilysahtnldicknglndalaelynlen
pkplydnglgrvgifkgsfeefleitkkyihknpivvkskevddnfklavlsgyglsqss
ikyvaekadvylsgdlthhskilaeelglvvvdathystevfglkkfkeflssnldleii
sldf

SCOPe Domain Coordinates for d3wsef_:

Click to download the PDB-style file with coordinates for d3wsef_.
(The format of our PDB-style files is described here.)

Timeline for d3wsef_: