Lineage for d3wq8d_ (3wq8 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2084115Species Pyrococcus furiosus [TaxId:2261] [267914] (1 PDB entry)
  8. 2084119Domain d3wq8d_: 3wq8 D: [265725]
    automated match to d2jf7a_
    mutant

Details for d3wq8d_

PDB Entry: 3wq8 (more details), 2.81 Å

PDB Description: Monomer structure of hyperthermophilic beta-glucosidase mutant forming a dodecameric structure in the crystal form
PDB Compounds: (D:) Beta-glucosidase

SCOPe Domain Sequences for d3wq8d_:

Sequence, based on SEQRES records: (download)

>d3wq8d_ c.1.8.0 (D:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
kfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhly
kqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikeleki
anmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldektv
vefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfnli
qahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkldw
igvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllkyln
nayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaqg
frmrfglvyvdfetkkrylrpsalvsvk

Sequence, based on observed residues (ATOM records): (download)

>d3wq8d_ c.1.8.0 (D:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
kfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhly
kqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikeleki
anmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldektv
vefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfnli
qahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkldw
igvnyysrlvygalvplpgygfmserggfaksgrpasdfgwemypeglenllkylnnaye
lpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaqgfrmr
fglvyvdfetkkrylrpsalvsvk

SCOPe Domain Coordinates for d3wq8d_:

Click to download the PDB-style file with coordinates for d3wq8d_.
(The format of our PDB-style files is described here.)

Timeline for d3wq8d_: