Lineage for d3wo4a_ (3wo4 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401197Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2401515Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins)
  6. 2401526Protein Interleukin-18 [101782] (1 species)
  7. 2401527Species Human (Homo sapiens) [TaxId:9606] [101783] (4 PDB entries)
  8. 2401538Domain d3wo4a_: 3wo4 A: [265717]
    automated match to d3wo2a_
    complexed with cl, nag

Details for d3wo4a_

PDB Entry: 3wo4 (more details), 3.1 Å

PDB Description: crystal structure of the il-18 signaling ternary complex
PDB Compounds: (A:) Interleukin-18

SCOPe Domain Sequences for d3wo4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wo4a_ b.42.1.2 (A:) Interleukin-18 {Human (Homo sapiens) [TaxId: 9606]}
yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm
avtisvkcekistlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
egyflacekerdlfklilkkedelgdrsimftvqned

SCOPe Domain Coordinates for d3wo4a_:

Click to download the PDB-style file with coordinates for d3wo4a_.
(The format of our PDB-style files is described here.)

Timeline for d3wo4a_: