Lineage for d3wmxd_ (3wmx D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095740Species Ralstonia eutropha [TaxId:381666] [229715] (8 PDB entries)
  8. 2095752Domain d3wmxd_: 3wmx D: [265716]
    automated match to d3a1nb_
    complexed with nad, thr

Details for d3wmxd_

PDB Entry: 3wmx (more details), 2.5 Å

PDB Description: GalE-like L-Threonine dehydrogenase from Cupriavidus necator (holo form)
PDB Compounds: (D:) NAD dependent epimerase/dehydratase

SCOPe Domain Sequences for d3wmxd_:

Sequence, based on SEQRES records: (download)

>d3wmxd_ c.2.1.0 (D:) automated matches {Ralstonia eutropha [TaxId: 381666]}
pkilivgangqigselalalaerygrtnvitsdvvptgrhvhlthemlnatdrgelatvv
erhgitqvyllaaalsatgekapqwawnlnmtsllnvlelarqtglervfwpssiaafgp
ttpagqtpqktvmepttvygiskqagegwcrwyhanhgvdvrsvrypglishktppgggt
tdyavdifhaavtgepytcflkedealpmmympdairatielmeapadklsergsyniag
msftpaqiaaaireqvpgfqiryepdyrqaiaqgwpdsiddsvaradwgwkaqyglkemv
admlanl

Sequence, based on observed residues (ATOM records): (download)

>d3wmxd_ c.2.1.0 (D:) automated matches {Ralstonia eutropha [TaxId: 381666]}
pkilivgangqigselalalaerygrtnvitsdvvptgrhvhlthemlnatdrgelatvv
erhgitqvyllaaalsatgekapqwawnlnmtsllnvlelarqtglervfwpssiaafgp
ttpagqtpqktvmepttvygiskqagegwcrwyhanhgvdvrsvrypglishktppttdy
avdifhaavtgepytcflkedealpmmympdairatielmeapadklsergsyniagmsf
tpaqiaaaireqvpgfqiryepdyrqaiaqgwpdsiddsvaradwgwkaqyglkemvadm
lanl

SCOPe Domain Coordinates for d3wmxd_:

Click to download the PDB-style file with coordinates for d3wmxd_.
(The format of our PDB-style files is described here.)

Timeline for d3wmxd_: