Lineage for d3wmxc_ (3wmx C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848232Species Ralstonia eutropha [TaxId:381666] [229715] (8 PDB entries)
  8. 2848243Domain d3wmxc_: 3wmx C: [265715]
    automated match to d3a1nb_
    complexed with nad, thr

Details for d3wmxc_

PDB Entry: 3wmx (more details), 2.5 Å

PDB Description: GalE-like L-Threonine dehydrogenase from Cupriavidus necator (holo form)
PDB Compounds: (C:) NAD dependent epimerase/dehydratase

SCOPe Domain Sequences for d3wmxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wmxc_ c.2.1.0 (C:) automated matches {Ralstonia eutropha [TaxId: 381666]}
pkilivgangqigselalalaerygrtnvitsdvvptgrhvhlthemlnatdrgelatvv
erhgitqvyllaaalsatgekapqwawnlnmtsllnvlelarqtglervfwpssiaafgp
ttpagqtpqktvmepttvygiskqagegwcrwyhanhgvdvrsvrypglishktppgggt
tdyavdifhaavtgepytcflkedealpmmympdairatielmeapadklsergsyniag
msftpaqiaaaireqvpgfqiryepdyrqaiaqgwpdsiddsvaradwgwkaqyglkemv
admlanlk

SCOPe Domain Coordinates for d3wmxc_:

Click to download the PDB-style file with coordinates for d3wmxc_.
(The format of our PDB-style files is described here.)

Timeline for d3wmxc_: