Lineage for d3wmmh1 (3wmm H:2-43)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2630999Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) (S)
  5. 2631129Family f.23.10.0: automated matches [227192] (1 protein)
    not a true family
  6. 2631130Protein automated matches [226917] (6 species)
    not a true protein
  7. 2631150Species Thermochromatium tepidum [TaxId:1050] [267910] (5 PDB entries)
  8. 2631153Domain d3wmmh1: 3wmm H:2-43 [265700]
    Other proteins in same PDB: d3wmm0_, d3wmm1_, d3wmm2_, d3wmm3_, d3wmm4_, d3wmm5_, d3wmm6_, d3wmm7_, d3wmm8_, d3wmm9_, d3wmma_, d3wmmb_, d3wmmc_, d3wmmd_, d3wmme_, d3wmmf_, d3wmmg_, d3wmmh2, d3wmmi_, d3wmmj_, d3wmmk_, d3wmmm_, d3wmmn_, d3wmmo_, d3wmmp_, d3wmmq_, d3wmmr_, d3wmms_, d3wmmt_, d3wmmu_, d3wmmv_, d3wmmw_, d3wmmx_, d3wmmy_, d3wmmz_
    automated match to d1eysh2
    complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, pgw, po4, uq8

Details for d3wmmh1

PDB Entry: 3wmm (more details), 3.01 Å

PDB Description: crystal structure of the lh1-rc complex from thermochromatium tepidum in c2 form
PDB Compounds: (H:) Photosynthetic reaction center H subunit

SCOPe Domain Sequences for d3wmmh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wmmh1 f.23.10.0 (H:2-43) automated matches {Thermochromatium tepidum [TaxId: 1050]}
sagithyidaaqitiwafwlfffgliiylrredkregyplds

SCOPe Domain Coordinates for d3wmmh1:

Click to download the PDB-style file with coordinates for d3wmmh1.
(The format of our PDB-style files is described here.)

Timeline for d3wmmh1: