Lineage for d3wksa1 (3wks A:21-396)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132627Species Methanocaldococcus jannaschii [TaxId:243232] [258609] (2 PDB entries)
  8. 2132628Domain d3wksa1: 3wks A:21-396 [265686]
    Other proteins in same PDB: d3wksa2, d3wksb2
    automated match to d3wkrb_
    protein/RNA complex

Details for d3wksa1

PDB Entry: 3wks (more details), 3.03 Å

PDB Description: crystal structure of the sepcyss-sepcyse n-terminal domain complex from
PDB Compounds: (A:) O-phospho-L-seryl-tRNA:Cys-tRNA synthase

SCOPe Domain Sequences for d3wksa1:

Sequence, based on SEQRES records: (download)

>d3wksa1 c.67.1.0 (A:21-396) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
dkyknltrsltrefinlnpiqrggilpkeakkavyeywdgysvcdychgrldevtcppik
dflediakflnmdcarpthgaregkfivmhaickegdyvvldknahytsyvaaeraklnv
aevgyeeeyptykinlegykevidnledkgknvglillthvdgeygnlndakkvgkiake
kgipfllncaytvgrmpvngkevkadfivasghksmaasapcgilafseefsdkitktse
kfpvkeiemlgctsrglpivtlmasfphvvervkkwdeelkktryvvdelekigfkqlgi
kpkehdlikfetpvldeiakkdkrrgfffydelkkrgiggiragvtkeikmsvygleweq
veyvvnaikeivesck

Sequence, based on observed residues (ATOM records): (download)

>d3wksa1 c.67.1.0 (A:21-396) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
dkyknltrsltrefinlnpiqrggilpkeakkavyeywdgppikdflediakflnmdcar
pthgaregkfivmhaickegdyvvldknahytsyvaaeraklnvaevgyeeeyptykinl
egykevidnledkgknvglillthvdgeygnlndakkvgkiakekgipfllncaytvgrm
pvngkevkadfivasghksmaasapcgilafseefsdkitktsekfpvkeiemlgctsrg
lpivtlmasfphvvervkkwdeelkktryvvdelekigfkqlgikpkehdlikfetpvld
eiakkdkrrgfffydelkkrgiggiragvtkeikmsvygleweqveyvvnaikeivesck

SCOPe Domain Coordinates for d3wksa1:

Click to download the PDB-style file with coordinates for d3wksa1.
(The format of our PDB-style files is described here.)

Timeline for d3wksa1:

  • d3wksa1 first appeared in SCOPe 2.05, called d3wksa_

View in 3D
Domains from same chain:
(mouse over for more information)
d3wksa2