Lineage for d3wkea1 (3wke A:2-227)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2166914Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2166915Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2166939Family c.108.1.2: YihX-like [56789] (3 proteins)
    the insertion subdomain is a 4-helical bundle
    automatically mapped to Pfam PF13419
  6. 2166940Protein Epoxide hydrolase, N-terminal domain [56790] (2 species)
    has a lipid phosphatase activity
  7. 2166941Species Human (Homo sapiens) [TaxId:9606] [102303] (35 PDB entries)
  8. 2166964Domain d3wkea1: 3wke A:2-227 [265684]
    Other proteins in same PDB: d3wkea2
    automated match to d1zd3a1
    complexed with aub, mg, po4

Details for d3wkea1

PDB Entry: 3wke (more details), 2.75 Å

PDB Description: crystal structure of soluble epoxide hydrolase in complex with t-aucb
PDB Compounds: (A:) Bifunctional epoxide hydrolase 2

SCOPe Domain Sequences for d3wkea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wkea1 c.108.1.2 (A:2-227) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitls
qwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttai
ltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevv
flddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpap

SCOPe Domain Coordinates for d3wkea1:

Click to download the PDB-style file with coordinates for d3wkea1.
(The format of our PDB-style files is described here.)

Timeline for d3wkea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wkea2