SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3wkaa1 (3wka A:2-227)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148571Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2148572Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2148596Family c.108.1.2: YihX-like [56789] (3 protein domains)
    the insertion subdomain is a 4-helical bundle
    automatically mapped to Pfam PF13419
  6. 2148597Protein Epoxide hydrolase, N-terminal domain [56790] (2 species)
    has a lipid phosphatase activity
  7. 2148598Species Human (Homo sapiens) [TaxId:9606] [102303] (35 PDB entries)
  8. 2148604Domain d3wkaa1: 3wka A:2-227 [265676]
    Other proteins in same PDB: d3wkaa2
    automated match to d1zd3a1
    complexed with mg, po4, s0g

Details for d3wkaa1

PDB Entry: 3wka (more details), 2.01 Å

PDB Description: Crystal structure of soluble epoxide hydrolase in complex with fragment inhibitor
PDB Compounds: (A:) Bifunctional epoxide hydrolase 2

SCOPe Domain Sequences for d3wkaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wkaa1 c.108.1.2 (A:2-227) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitls
qwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttai
ltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevv
flddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpap

SCOPe Domain Coordinates for d3wkaa1:

Click to download the PDB-style file with coordinates for d3wkaa1.
(The format of our PDB-style files is described here.)

Timeline for d3wkaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wkaa2