Lineage for d1b6ja_ (1b6j A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15696Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 15712Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 15713Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (108 PDB entries)
  8. 15776Domain d1b6ja_: 1b6j A: [26567]

Details for d1b6ja_

PDB Entry: 1b6j (more details), 1.85 Å

PDB Description: hiv-1 protease complexed with macrocyclic peptidomimetic inhibitor 1

SCOP Domain Sequences for d1b6ja_:

Sequence, based on SEQRES records: (download)

>d1b6ja_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveixghkaigtvlvgptpvniigrnlltqigxtlnf

Sequence, based on observed residues (ATOM records): (download)

>d1b6ja_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveighkaigtvlvgptpvniigrnlltqigtlnf

SCOP Domain Coordinates for d1b6ja_:

Click to download the PDB-style file with coordinates for d1b6ja_.
(The format of our PDB-style files is described here.)

Timeline for d1b6ja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b6jb_