Lineage for d3whce2 (3whc E:78-193)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011555Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2011556Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2011557Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2011877Protein automated matches [226970] (7 species)
    not a true protein
  7. 2011885Species Bacillus subtilis [TaxId:224308] [267908] (2 PDB entries)
  8. 2011892Domain d3whce2: 3whc E:78-193 [265660]
    Other proteins in same PDB: d3whca1, d3whcb1, d3whcc1, d3whcd1, d3whce1, d3whcf1
    automated match to d1vi0a2
    complexed with st9

Details for d3whce2

PDB Entry: 3whc (more details), 2.2 Å

PDB Description: crystal structure of a transcriptional regulator fadr from bacillus subtilis in complex with stearoyl-coa
PDB Compounds: (E:) fatty acid metabolism regulator protein

SCOPe Domain Sequences for d3whce2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3whce2 a.121.1.1 (E:78-193) automated matches {Bacillus subtilis [TaxId: 224308]}
takeklalviskhfsllagdhnlaivtqlelrqsnlelrqkineilkgylnildgilteg
iqsgeikegldvrlarqmifgtidetvttwvmndqkydlvalsnsvlellvsgihn

SCOPe Domain Coordinates for d3whce2:

Click to download the PDB-style file with coordinates for d3whce2.
(The format of our PDB-style files is described here.)

Timeline for d3whce2: