| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
| Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
| Protein automated matches [226970] (7 species) not a true protein |
| Species Bacillus subtilis [TaxId:224308] [267908] (2 PDB entries) |
| Domain d3whce2: 3whc E:78-193 [265660] Other proteins in same PDB: d3whca1, d3whcb1, d3whcc1, d3whcd1, d3whce1, d3whcf1 automated match to d1vi0a2 complexed with st9 |
PDB Entry: 3whc (more details), 2.2 Å
SCOPe Domain Sequences for d3whce2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3whce2 a.121.1.1 (E:78-193) automated matches {Bacillus subtilis [TaxId: 224308]}
takeklalviskhfsllagdhnlaivtqlelrqsnlelrqkineilkgylnildgilteg
iqsgeikegldvrlarqmifgtidetvttwvmndqkydlvalsnsvlellvsgihn
Timeline for d3whce2: