Lineage for d3whcb2 (3whc B:78-193)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1746767Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 1746768Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 1746769Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 1747049Protein automated matches [226970] (4 species)
    not a true protein
  7. 1747057Species Bacillus subtilis [TaxId:224308] [267908] (2 PDB entries)
  8. 1747061Domain d3whcb2: 3whc B:78-193 [265654]
    Other proteins in same PDB: d3whca1, d3whcb1, d3whcc1, d3whcd1, d3whce1, d3whcf1
    automated match to d1vi0a2
    complexed with st9

Details for d3whcb2

PDB Entry: 3whc (more details), 2.2 Å

PDB Description: crystal structure of a transcriptional regulator fadr from bacillus subtilis in complex with stearoyl-coa
PDB Compounds: (B:) fatty acid metabolism regulator protein

SCOPe Domain Sequences for d3whcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3whcb2 a.121.1.1 (B:78-193) automated matches {Bacillus subtilis [TaxId: 224308]}
takeklalviskhfsllagdhnlaivtqlelrqsnlelrqkineilkgylnildgilteg
iqsgeikegldvrlarqmifgtidetvttwvmndqkydlvalsnsvlellvsgihn

SCOPe Domain Coordinates for d3whcb2:

Click to download the PDB-style file with coordinates for d3whcb2.
(The format of our PDB-style files is described here.)

Timeline for d3whcb2: