![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
![]() | Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
![]() | Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
![]() | Protein automated matches [226970] (6 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:224308] [267908] (2 PDB entries) |
![]() | Domain d3whbb2: 3whb B:78-192 [265650] Other proteins in same PDB: d3whba1, d3whbb1 automated match to d1vi0a2 complexed with dcc |
PDB Entry: 3whb (more details), 2.15 Å
SCOPe Domain Sequences for d3whbb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3whbb2 a.121.1.1 (B:78-192) automated matches {Bacillus subtilis [TaxId: 224308]} takeklalviskhfsllagdhnlaivtqlelrqsnlelrqkineilkgylnildgilteg iqsgeikegldvrlarqmifgtidetvttwvmndqkydlvalsnsvlellvsgih
Timeline for d3whbb2: