SCOPe 2.08: Domain d3whbb2: 3whb B:78-192

Lineage for d3whbb2 (3whb B:78-192)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein automated matches [226970] (6 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [267908] (2 PDB entries)

8. Domain d3whbb2: 3whb B:78-192 [265650]
   Other proteins in same PDB: d3whba1, d3whbb1
   automated match to d1vi0a2
   complexed with dcc

Details for d3whbb2

PDB Entry: 3whb, 2.15 Å

PDB Description: crystal structure of fadr from bacillus subtilis, a transcriptional regulator involved in the regulation of fatty acid degradation

PDB Compounds: (B:) fatty acid metabolism regulator protein

SCOPe Domain Sequences for d3whbb2:

Sequence; same for both SEQRES and ATOM records:

>d3whbb2 a.121.1.1 (B:78-192) automated matches {Bacillus subtilis [TaxId: 224308]}
takeklalviskhfsllagdhnlaivtqlelrqsnlelrqkineilkgylnildgilteg
iqsgeikegldvrlarqmifgtidetvttwvmndqkydlvalsnsvlellvsgih

Timeline for d3whbb2:

• d3whbb2 first appeared in SCOPe 2.05
  
• d3whbb2 appears in SCOPe 2.07