Lineage for d3whba2 (3whb A:78-193)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2727852Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2728220Protein automated matches [226970] (6 species)
    not a true protein
  7. 2728228Species Bacillus subtilis [TaxId:224308] [267908] (2 PDB entries)
  8. 2728229Domain d3whba2: 3whb A:78-193 [265648]
    Other proteins in same PDB: d3whba1, d3whbb1
    automated match to d1vi0a2
    complexed with dcc

Details for d3whba2

PDB Entry: 3whb (more details), 2.15 Å

PDB Description: crystal structure of fadr from bacillus subtilis, a transcriptional regulator involved in the regulation of fatty acid degradation
PDB Compounds: (A:) fatty acid metabolism regulator protein

SCOPe Domain Sequences for d3whba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3whba2 a.121.1.1 (A:78-193) automated matches {Bacillus subtilis [TaxId: 224308]}
takeklalviskhfsllagdhnlaivtqlelrqsnlelrqkineilkgylnildgilteg
iqsgeikegldvrlarqmifgtidetvttwvmndqkydlvalsnsvlellvsgihn

SCOPe Domain Coordinates for d3whba2:

Click to download the PDB-style file with coordinates for d3whba2.
(The format of our PDB-style files is described here.)

Timeline for d3whba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3whba1