Lineage for d3whba1 (3whb A:5-77)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692712Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2692713Protein automated matches [190674] (25 species)
    not a true protein
  7. 2692731Species Bacillus subtilis [TaxId:224308] [267907] (2 PDB entries)
  8. 2692732Domain d3whba1: 3whb A:5-77 [265647]
    Other proteins in same PDB: d3whba2, d3whbb2
    automated match to d1vi0a1
    complexed with dcc

Details for d3whba1

PDB Entry: 3whb (more details), 2.15 Å

PDB Description: crystal structure of fadr from bacillus subtilis, a transcriptional regulator involved in the regulation of fatty acid degradation
PDB Compounds: (A:) fatty acid metabolism regulator protein

SCOPe Domain Sequences for d3whba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3whba1 a.4.1.0 (A:5-77) automated matches {Bacillus subtilis [TaxId: 224308]}
rpkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfkekmgq
fiermeedikeka

SCOPe Domain Coordinates for d3whba1:

Click to download the PDB-style file with coordinates for d3whba1.
(The format of our PDB-style files is described here.)

Timeline for d3whba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3whba2