SCOPe 2.08: Domain d3whba1: 3whb A:5-77

Lineage for d3whba1 (3whb A:5-77)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (25 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [267907] (2 PDB entries)

8. Domain d3whba1: 3whb A:5-77 [265647]
   Other proteins in same PDB: d3whba2, d3whbb2
   automated match to d1vi0a1
   complexed with dcc

Details for d3whba1

PDB Entry: 3whb, 2.15 Å

PDB Description: crystal structure of fadr from bacillus subtilis, a transcriptional regulator involved in the regulation of fatty acid degradation

PDB Compounds: (A:) fatty acid metabolism regulator protein

SCOPe Domain Sequences for d3whba1:

Sequence; same for both SEQRES and ATOM records:

>d3whba1 a.4.1.0 (A:5-77) automated matches {Bacillus subtilis [TaxId: 224308]}
rpkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfkekmgq
fiermeedikeka

Timeline for d3whba1:

• d3whba1 first appeared in SCOPe 2.05
  
• d3whba1 appears in SCOPe 2.07