Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
Domain d3wfel1: 3wfe L:1-107 [265641] Other proteins in same PDB: d3wfel2 automated match to d2fd6l1 complexed with 10m, ca, cyn, fe, hec, hem |
PDB Entry: 3wfe (more details), 2.49 Å
SCOPe Domain Sequences for d3wfel1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wfel1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]} diqmtqsppylaaspgetitincrasksirkylawyqekpgktnklliysgstlqfgips rfsgsgsgteftltisslepedfamyycqqhneypltfgagtklelk
Timeline for d3wfel1: