Lineage for d3wclf_ (3wcl F:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1749121Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1749122Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1749240Family a.128.1.2: Squalene synthase [48580] (2 proteins)
    automatically mapped to Pfam PF00494
  6. 1749246Protein automated matches [191305] (1 species)
    not a true protein
  7. 1749247Species Human (Homo sapiens) [TaxId:9606] [190011] (24 PDB entries)
  8. 1749282Domain d3wclf_: 3wcl F: [265630]
    automated match to d3vjbc_
    complexed with bh3

Details for d3wclf_

PDB Entry: 3wcl (more details), 2.24 Å

PDB Description: The complex structure of HsSQS wtih ligand,BPH1344
PDB Compounds: (F:) Squalene synthase

SCOPe Domain Sequences for d3wclf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wclf_ a.128.1.2 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lssslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekkvp
llhnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgigma
efldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqktn
iirdyledqqggrefwpqevwsryvkklgdfalpenidlavqclnelitnalhhipdvit
ylsrlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavlirlgqavtlmmdatnmpavk
aiiyqymeeiyhripdsnpsssktrqiistirtq

SCOPe Domain Coordinates for d3wclf_:

Click to download the PDB-style file with coordinates for d3wclf_.
(The format of our PDB-style files is described here.)

Timeline for d3wclf_: