SCOPe 2.06: Domain d3wcla_: 3wcl A:

Lineage for d3wcla_ (3wcl A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.2: Squalene synthase [48580] (2 proteins)
   automatically mapped to Pfam PF00494

6. Protein automated matches [191305] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [190011] (24 PDB entries)

8. Domain d3wcla_: 3wcl A: [265625]
   automated match to d3vjbc_
   complexed with bh3

Details for d3wcla_

PDB Entry: 3wcl, 2.24 Å

PDB Description: The complex structure of HsSQS wtih ligand,BPH1344

PDB Compounds: (A:) Squalene synthase

SCOPe Domain Sequences for d3wcla_:

Sequence; same for both SEQRES and ATOM records:

>d3wcla_ a.128.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lssslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekkvp
llhnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgigma
efldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqktn
iirdyledqqggrefwpqevwsryvkklgdfalpenidlavqclnelitnalhhipdvit
ylsrlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavlirlgqavtlmmdatnmpavk
aiiyqymeeiyhripdsnpsssktrqiistirtq

Timeline for d3wcla_:

• d3wcla_ first appeared in SCOPe 2.05
  
• d3wcla_ appears in SCOPe 2.07
  
• d3wcla_ appears in the current release, SCOPe 2.08