![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
![]() | Superfamily a.128.1: Terpenoid synthases [48576] (6 families) ![]() duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
![]() | Family a.128.1.2: Squalene synthase [48580] (2 proteins) automatically mapped to Pfam PF00494 |
![]() | Protein automated matches [191305] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [190011] (24 PDB entries) |
![]() | Domain d3wcfd_: 3wcf D: [265610] automated match to d3vjbc_ complexed with bh8 |
PDB Entry: 3wcf (more details), 2.22 Å
SCOPe Domain Sequences for d3wcfd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wcfd_ a.128.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lssslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekkvp llhnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgigma efldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqktn iirdyledqqggrefwpqevwsryvkklgdfalpenidlavqclnelitnalhhipdvit ylsrlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavlirlgqavtlmmdatnmpavk aiiyqymeeiyhripdsnpsssktrqiistirtq
Timeline for d3wcfd_: