Lineage for d3wcea_ (3wce A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1749121Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1749122Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1749472Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 1749473Protein automated matches [196409] (30 species)
    not a true protein
  7. 1749593Species Trypanosoma cruzi [TaxId:353153] [256465] (6 PDB entries)
  8. 1749606Domain d3wcea_: 3wce A: [265603]
    automated match to d3wcba_
    complexed with er4

Details for d3wcea_

PDB Entry: 3wce (more details), 2.75 Å

PDB Description: The complex structure of TcSQS with ligand, ER119884
PDB Compounds: (A:) Farnesyltransferase, putative

SCOPe Domain Sequences for d3wcea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wcea_ a.128.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
dedlrfcydilqavsrsfavvimeldeemrdavcifylvlraldtveddmsipvefklre
lpkfhehlhdttwcmsgvgvgrerellerythvtraysrlgkayqdvisgicermangmc
dfltrkvetkadydlychyvaglvghgltllyvssgledvrladdltnanhmglflqktn
iirdfyedicevpprvfwpreiwekytddlhafkdelheakaveclnamvadalvhvphv
veylaslrdpsvfafsaipqvmamatlslvfnnkdvfhtkvkttrgatarifhystelqa
tlqmlktytlrlaarmnaqdacydriehlvndairameshq

SCOPe Domain Coordinates for d3wcea_:

Click to download the PDB-style file with coordinates for d3wcea_.
(The format of our PDB-style files is described here.)

Timeline for d3wcea_: