SCOPe 2.03: Domain d1g6la1: 1g6l A:1-99

Lineage for d1g6la1 (1g6l A:1-99)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (8 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (421 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d1g6la1: 1g6l A:1-99 [26559]
   synthetic tethered dimer

Details for d1g6la1

PDB Entry: 1g6l, 1.9 Å

PDB Description: 1.9a crystal structure of tethered hiv-1 protease

PDB Compounds: (A:) hiv-1 protease

SCOPe Domain Sequences for d1g6la1:

Sequence; same for both SEQRES and ATOM records:

>d1g6la1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigmtlnf

Timeline for d1g6la1:

• d1g6la1 first appeared (with stable ids) in SCOP 1.55
  
• d1g6la1 appears in SCOPe 2.02
  
• d1g6la1 appears in SCOPe 2.04
  
• d1g6la1 appears in the current release, SCOPe 2.08