SCOPe 2.06: Domain d3w39d2: 3w39 D:183-277

Lineage for d3w39d2 (3w39 D:183-277)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (199 PDB entries)
   Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor

8. Domain d3w39d2: 3w39 D:183-277 [265588]
   Other proteins in same PDB: d3w39d1, d3w39d3
   automated match to d1a9ea1

Details for d3w39d2

PDB Entry: 3w39, 3.1 Å

PDB Description: Crystal structure of HLA-B*5201 in complexed with HIV immunodominant epitope (TAFTIPSI)

PDB Compounds: (D:) HLA class I histocompatibility antigen, B-52 alpha chain

SCOPe Domain Sequences for d3w39d2:

Sequence; same for both SEQRES and ATOM records:

>d3w39d2 b.1.1.2 (D:183-277) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

Timeline for d3w39d2:

• d3w39d2 first appeared in SCOPe 2.05
  
• d3w39d2 appears in SCOPe 2.07
  
• d3w39d2 appears in the current release, SCOPe 2.08