![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
![]() | Species Human (Homo sapiens), HLA-B51 [TaxId:9606] [54476] (3 PDB entries) |
![]() | Domain d3w39d1: 3w39 D:2-182 [265587] Other proteins in same PDB: d3w39d2, d3w39d3 automated match to d1e27a2 |
PDB Entry: 3w39 (more details), 3.1 Å
SCOPe Domain Sequences for d3w39d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w39d1 d.19.1.1 (D:2-182) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B51 [TaxId: 9606]} gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw dretqisktntqtyrenlrialryynqseagshtwqtmygcdvgpdgrllrghnqyaydg kdyialnedlsswtaadtaaqitqrkweaareaeqlrayleglcvewlrrhlengketlq r
Timeline for d3w39d1: