Lineage for d3w39d1 (3w39 D:2-182)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2937908Species Human (Homo sapiens), HLA-B51 [TaxId:9606] [54476] (3 PDB entries)
  8. 2937911Domain d3w39d1: 3w39 D:2-182 [265587]
    Other proteins in same PDB: d3w39d2, d3w39d3
    automated match to d1e27a2

Details for d3w39d1

PDB Entry: 3w39 (more details), 3.1 Å

PDB Description: Crystal structure of HLA-B*5201 in complexed with HIV immunodominant epitope (TAFTIPSI)
PDB Compounds: (D:) HLA class I histocompatibility antigen, B-52 alpha chain

SCOPe Domain Sequences for d3w39d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w39d1 d.19.1.1 (D:2-182) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B51 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
dretqisktntqtyrenlrialryynqseagshtwqtmygcdvgpdgrllrghnqyaydg
kdyialnedlsswtaadtaaqitqrkweaareaeqlrayleglcvewlrrhlengketlq
r

SCOPe Domain Coordinates for d3w39d1:

Click to download the PDB-style file with coordinates for d3w39d1.
(The format of our PDB-style files is described here.)

Timeline for d3w39d1: