SCOPe 2.05: Domain d3w2dl2: 3w2d L:131-237

Lineage for d3w2dl2 (3w2d L:131-237)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)

8. Domain d3w2dl2: 3w2d L:131-237 [265586]
   Other proteins in same PDB: d3w2da1, d3w2da2, d3w2dl1
   automated match to d2i9la2
   complexed with so4

Details for d3w2dl2

PDB Entry: 3w2d, 3.1 Å

PDB Description: Crystal Structure of Staphylococcal Eenterotoxin B in complex with a novel neutralization monoclonal antibody Fab fragment

PDB Compounds: (L:) Monoclonal Antibody 3E2 Fab figment light chain

SCOPe Domain Sequences for d3w2dl2:

Sequence; same for both SEQRES and ATOM records:

>d3w2dl2 b.1.1.2 (L:131-237) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d3w2dl2:

• d3w2dl2 is new in SCOPe 2.05-stable
  
• d3w2dl2 appears in SCOPe 2.06
  
• d3w2dl2 appears in the current release, SCOPe 2.08