| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.10: DNA-binding domain [54170] (1 superfamily) beta(3)-alpha; 2 layers: alpha/beta |
Superfamily d.10.1: DNA-binding domain [54171] (5 families) ![]() |
| Family d.10.1.0: automated matches [254255] (1 protein) not a true family |
| Protein automated matches [254589] (3 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [267905] (3 PDB entries) |
| Domain d3vyqd_: 3vyq D: [265582] automated match to d2moea_ protein/DNA complex; complexed with edo, zn |
PDB Entry: 3vyq (more details), 2.52 Å
SCOPe Domain Sequences for d3vyqd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vyqd_ d.10.1.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hkpvpcgwervvkqrlsgktagkfdvyfispqglkfrskrslanyllkngetflkpedfn
ftv
Timeline for d3vyqd_: