Lineage for d3vyqd_ (3vyq D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536609Fold d.10: DNA-binding domain [54170] (1 superfamily)
    beta(3)-alpha; 2 layers: alpha/beta
  4. 2536610Superfamily d.10.1: DNA-binding domain [54171] (5 families) (S)
  5. 2536644Family d.10.1.0: automated matches [254255] (1 protein)
    not a true family
  6. 2536645Protein automated matches [254589] (3 species)
    not a true protein
  7. 2536651Species Mouse (Mus musculus) [TaxId:10090] [267905] (3 PDB entries)
  8. 2536655Domain d3vyqd_: 3vyq D: [265582]
    automated match to d2moea_
    protein/DNA complex; complexed with edo, zn

Details for d3vyqd_

PDB Entry: 3vyq (more details), 2.52 Å

PDB Description: Crystal structure of the methyl CpG Binding Domain of MBD4 in complex with the 5mCG/TG sequence in space group P1
PDB Compounds: (D:) Methyl-CpG-binding domain protein 4

SCOPe Domain Sequences for d3vyqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vyqd_ d.10.1.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hkpvpcgwervvkqrlsgktagkfdvyfispqglkfrskrslanyllkngetflkpedfn
ftv

SCOPe Domain Coordinates for d3vyqd_:

Click to download the PDB-style file with coordinates for d3vyqd_.
(The format of our PDB-style files is described here.)

Timeline for d3vyqd_: