SCOPe 2.08: Domain d3vyqa_: 3vyq A:

Lineage for d3vyqa_ (3vyq A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.10: DNA-binding domain [54170] (1 superfamily)
   beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.10.1: DNA-binding domain [54171] (5 families)

5. Family d.10.1.0: automated matches [254255] (1 protein)
   not a true family

6. Protein automated matches [254589] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [267905] (3 PDB entries)

8. Domain d3vyqa_: 3vyq A: [265581]
   automated match to d2moea_
   protein/DNA complex; complexed with edo, zn

Details for d3vyqa_

PDB Entry: 3vyq, 2.52 Å

PDB Description: Crystal structure of the methyl CpG Binding Domain of MBD4 in complex with the 5mCG/TG sequence in space group P1

PDB Compounds: (A:) Methyl-CpG-binding domain protein 4

SCOPe Domain Sequences for d3vyqa_:

Sequence; same for both SEQRES and ATOM records:

>d3vyqa_ d.10.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hkpvpcgwervvkqrlsgktagkfdvyfispqglkfrskrslanyllkngetflkpedfn
ftv

Timeline for d3vyqa_:

• d3vyqa_ first appeared in SCOPe 2.05
  
• d3vyqa_ appears in SCOPe 2.07