Lineage for d1mesb_ (1mes B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1796116Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1796117Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1796118Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1796134Protein Human immunodeficiency virus type 1 protease [50632] (8 species)
  7. 1796358Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (446 PDB entries)
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. 1796859Domain d1mesb_: 1mes B: [26558]
    complexed with dmp; mutant

Details for d1mesb_

PDB Entry: 1mes (more details), 1.9 Å

PDB Description: hiv-1 mutant (i84v) protease complexed with dmp323
PDB Compounds: (B:) hiv-1 protease

SCOPe Domain Sequences for d1mesb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mesb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvnvigrnlltqigctlnf

SCOPe Domain Coordinates for d1mesb_:

Click to download the PDB-style file with coordinates for d1mesb_.
(The format of our PDB-style files is described here.)

Timeline for d1mesb_: