Lineage for d3vxva_ (3vxv A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929442Fold d.10: DNA-binding domain [54170] (1 superfamily)
    beta(3)-alpha; 2 layers: alpha/beta
  4. 2929443Superfamily d.10.1: DNA-binding domain [54171] (5 families) (S)
  5. 2929477Family d.10.1.0: automated matches [254255] (1 protein)
    not a true family
  6. 2929478Protein automated matches [254589] (3 species)
    not a true protein
  7. 2929484Species Mouse (Mus musculus) [TaxId:10090] [267905] (3 PDB entries)
  8. 2929485Domain d3vxva_: 3vxv A: [265579]
    automated match to d2moea_
    protein/DNA complex; complexed with act, edo

Details for d3vxva_

PDB Entry: 3vxv (more details), 2 Å

PDB Description: Crystal structure of methyl CpG Binding Domain of MBD4 in complex with the 5mCG/TG sequence
PDB Compounds: (A:) Methyl-CpG-binding domain protein 4

SCOPe Domain Sequences for d3vxva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vxva_ d.10.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kpvpcgwervvkqrlsgktagkfdvyfispqglkfrskrslanyllkngetflkpedfnf
tvlpk

SCOPe Domain Coordinates for d3vxva_:

Click to download the PDB-style file with coordinates for d3vxva_.
(The format of our PDB-style files is described here.)

Timeline for d3vxva_: