![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.10: DNA-binding domain [54170] (1 superfamily) beta(3)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.10.1: DNA-binding domain [54171] (5 families) ![]() |
![]() | Family d.10.1.0: automated matches [254255] (1 protein) not a true family |
![]() | Protein automated matches [254589] (3 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [267905] (3 PDB entries) |
![]() | Domain d3vxva_: 3vxv A: [265579] automated match to d2moea_ protein/DNA complex; complexed with act, edo |
PDB Entry: 3vxv (more details), 2 Å
SCOPe Domain Sequences for d3vxva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vxva_ d.10.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} kpvpcgwervvkqrlsgktagkfdvyfispqglkfrskrslanyllkngetflkpedfnf tvlpk
Timeline for d3vxva_: