Lineage for d3voza1 (3voz A:221-531)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2245342Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2245343Protein automated matches [190857] (40 species)
    not a true protein
  7. 2245538Species Human (Homo sapiens) [TaxId:9606] [255788] (12 PDB entries)
  8. 2245545Domain d3voza1: 3voz A:221-531 [265573]
    Other proteins in same PDB: d3voza2
    automated match to d4o7da_
    complexed with 04a, so4

Details for d3voza1

PDB Entry: 3voz (more details), 2.4 Å

PDB Description: Crystal structure of human glutaminase in complex with BPTES
PDB Compounds: (A:) Glutaminase kidney isoform, mitochondrial

SCOPe Domain Sequences for d3voza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3voza1 e.3.1.0 (A:221-531) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipdfmsftshidelyesakkqsggkvadyipqlakfspdlwgvsvctvdgqrhstgdtkv
pfclqscvkplkyaiavndlgteyvhryvgkepsglrfnklflneddkphnpmvnagaiv
vtslikqgvnnaekfdyvmqflnkmagneyvgfsnatfqseresgdrnfaigyylkekkc
fpegtdmvgildfyfqlcsievtcesasvmaatlanggfcpitgervlspeavrntlslm
hscgmydfsgqfafhvglpaksgvaggillvvpnvmgmmcwsppldkmgnsvkgihfchd
lvslcnfhnyd

SCOPe Domain Coordinates for d3voza1:

Click to download the PDB-style file with coordinates for d3voza1.
(The format of our PDB-style files is described here.)

Timeline for d3voza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3voza2